ATP6V1E1 Antibody [HRP]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: HRP

ATP6V1E1 Antibody [HRP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 77-226 of human ATP6V1E1 (NP_001687.1).
  
  Sequence:
  NQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V1E1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Alternate Names for ATP6V1E1 Antibody [HRP]

• ATP6E2ATP6V1E
• ATP6E31kDa subunit
• ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD
• ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 1
• ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
• H+-transporting ATP synthase chain E, vacuolar
• p31
• Vacuolar proton pump subunit E 1
• V-ATPase 31 kDa subunit
• V-ATPase subunit E 1
• V-ATPase, subunit E
• Vma4
• V-type proton ATPase subunit E 1

Background

ATP6V1E1 encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V1E1