ATP6V1E1 Antibody - Azide and BSA Free

Western Blot: ATP6V1E1 Antibody [H00000529-D01P] - Analysis of ATP6V1E1 expression in mouse lung.

Western Blot: ATP6V1E1 Antibody [H00000529-D01P] - Analysis of ATP6V1E1 expression in Jurkat.

Western Blot: ATP6V1E1 Antibody [H00000529-D01P] - Analysis of ATP6V1E1 expression in human kidney.

Western Blot: ATP6V1E1 Antibody [H00000529-D01P] - Analysis of ATP6V1E1 expression in transfected 293T cell line by ATP6V1E1 polyclonal antibody.Lane 1: ATP6V1E1 transfected lysate(26.10 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP6V1E1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ATP6V1E1 (NP_001687.1, 1 a.a. - 226 a.a.) full-length human protein. MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD
• Specificity: Reacts with ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP6V1E1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V1E1 Antibody - Azide and BSA Free

• ATP6E2ATP6V1E
• ATP6E31kDa subunit
• ATPase, H+ transporting, lysosomal (vacuolar proton pump) 31kD
• ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E isoform 1
• ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1
• H+-transporting ATP synthase chain E, vacuolar
• p31
• Vacuolar proton pump subunit E 1
• V-ATPase 31 kDa subunit
• V-ATPase subunit E 1
• V-ATPase, subunit E
• Vma4
• V-type proton ATPase subunit E 1

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. This gene encodes alternate transcriptional splice variants, encoding different V1 domain E subunit isoforms. Pseudogenes for this gene have been found in the genome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V1E1
• Entrez:
  • 529(Human)
• Uniprot:
  • NP_001687.1(Human)