ATP6V0D1 Antibody (3B8) - Azide and BSA Free

Western Blot: ATP6V0D1 Antibody (3B8) [H00009114-M02] - ATP6V0D1 monoclonal antibody (M02), clone 3B8. Analysis of ATP6V0D1 expression in HeLa.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3B8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATP6V0D1 Antibody (3B8) - Azide and BSA Free Summary

• Immunogen: ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATP6V0D1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATP6V0D1 Antibody (3B8) - Azide and BSA Free

• 32 kDa accessory protein
• ATP6D
• ATP6DV
• ATP6V0
• ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D
• ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1
• ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1
• FLJ43534
• H(+)-transporting two-sector ATPase, subunit D
• P39
• Vacuolar proton pump subunit d 1
• V-ATPase 40 kDa accessory protein
• V-ATPase AC39 subunit
• V-ATPase, subunit D
• VATX
• Vma6
• VPATPDV-ATPase subunit d 1
• V-type proton ATPase subunit d 1

Background

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP6V0D1
• Uniprot:
  • NP_004682(Human)