ATP13A2 Antibody - BSA Free

Immunohistochemistry: ATP13A2 Antibody [NBP2-48985] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Discontinued

ATP13A2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RGCGMVAPQEHLIIVHATHPERGQPASLEFLPMESPTAVNGVKDPDQAASYTVEPDPRSRHLALSGPTFGIIVKHFPKLLPKV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP13A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP13A2 Antibody - BSA Free

• ATPase type 13A2
• EC 3.6.3
• EC 3.6.3.-
• EC 3.6.3.5
• EC 3.6.3.8
• FLJ26510
• HSA9947
• KRPPD
• PARK9putative ATPase
• Parkinson disease (autosomal recessive) 9 (Kufor-Rakeb syndrome)
• probable cation-transporting ATPase 13A2

Background

Neurodegenerative disorders such as Parkinson and Alzheimer disease cause motor and cognitive dysfunction and belong to a heterogeneous group of common and disabling disorders. ATP13A2, otherwise known as PARK9, is a neuronal P-type ATPase gene underlying an autosomal recessive form of early-onset parkinsonism with pyramidal degeneration and dementia. ATP13A2 protein is located in the membrane of these lysosomes and is formed most strongly in the brain, especially in the substantia nigra, a brain region which is known to play a central role in Parkinson's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP13A2