ATP11A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ATP11A Antibody [NBP1-88904] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry: ATP11A Antibody [NBP1-88904] - Staining of human kidney shows strong cytoplasmic and membranous positivity in distal tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP11A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP11A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATP11A Protein (NBP1-88904PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP11A Antibody

  • ATPase, class VI, type 11A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71805
Species: Hu
Applications: WB, IP
NBP1-88902
Species: Hu
Applications: IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-2070
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14959
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88584
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57098
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP1-81745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77190
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IF
NLS932
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00023263-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33415
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-30403
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
H00004168-B01P-50ug
Species: Hu
Applications: WB

Publications for ATP11A Antibody (NBP1-88904) (0)

There are no publications for ATP11A Antibody (NBP1-88904).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP11A Antibody (NBP1-88904) (0)

There are no reviews for ATP11A Antibody (NBP1-88904). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ATP11A Antibody (NBP1-88904) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP11A Products

Bioinformatics Tool for ATP11A Antibody (NBP1-88904)

Discover related pathways, diseases and genes to ATP11A Antibody (NBP1-88904). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP11A Antibody (NBP1-88904)

Discover more about diseases related to ATP11A Antibody (NBP1-88904).
 

Pathways for ATP11A Antibody (NBP1-88904)

View related products by pathway.

Blogs on ATP11A

There are no specific blogs for ATP11A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP11A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP11A