ATP10D Antibody - BSA Free

Western Blot: ATP10D Antibody [NBP1-59982] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ATP10D Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ATP10D(ATPase, class V, type 10D) The peptide sequence was selected from the C terminal of ATP10D. Peptide sequence LFTSAPPVIYGVLEKDVSAETLMQLPELYRSGQKSEAYLPHTFWITLLDA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP10D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ATP10D Antibody - BSA Free

• ATPase, class V, type 10D
• ATPVDtype IV aminophospholipid transporting ATPase
• EC 3.6.3
• EC 3.6.3.1
• KIAA1487ATPase class V type 10D
• probable phospholipid-transporting ATPase VD

Background

ATP10D is a multi-pass membrane protein. It belongs to the cation transport ATPase (P-type) family, type IV subfamily. The exact function of ATP10D remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP10D
• Uniprot:
  • Q9P241(Human)