ATP10A Antibody

Images

 
Immunohistochemistry: ATP10A Antibody [NBP2-30807] - Immunohistochemical staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

ATP10A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PTQLQLARQLTRKSPRRCSAPKETFAQGRLPKDSGTEHSSGRTVKTSVPLSQPSWHTQQPVCSLEASGEPSTVDMSMPVREHTLLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP10A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Control Peptide
ATP10A Protein (NBP2-30807PEP)

Alternate Names for ATP10A Antibody

  • probable phospholipid-transporting ATPase VA
  • ATP10C
  • ATPase, class V, type 10A
  • ATPVA
  • ATPVC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-240
Species: Hu, Mu
Applications: WB, IP
NBP2-30403
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83280
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC-FrFl
NBP1-60052
Species: Hu
Applications: WB
NBP2-46117
Species: Hu
Applications: WB, IHC, IF
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-02509
Species: Hu
Applications: ELISA, IHC, IHC-P
H00006334-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-84881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28875
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-89513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000292-B01P
Species: Hu
Applications: WB, ELISA
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for ATP10A Antibody (NBP2-30807) (0)

There are no publications for ATP10A Antibody (NBP2-30807).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP10A Antibody (NBP2-30807) (0)

There are no reviews for ATP10A Antibody (NBP2-30807). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP10A Antibody (NBP2-30807) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP10A Antibody Products

Related Products by Gene

Bioinformatics Tool for ATP10A Antibody (NBP2-30807)

Discover related pathways, diseases and genes to ATP10A Antibody (NBP2-30807). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP10A Antibody (NBP2-30807)

Discover more about diseases related to ATP10A Antibody (NBP2-30807).
 

Pathways for ATP10A Antibody (NBP2-30807)

View related products by pathway.

PTMs for ATP10A Antibody (NBP2-30807)

Learn more about PTMs related to ATP10A Antibody (NBP2-30807).

Blogs on ATP10A

There are no specific blogs for ATP10A, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ATP10A
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-30807 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought