ATOX1 Antibody (2E6) - Azide and BSA Free

Western Blot: ATOX1 Antibody (2E6) [H00000475-M01] - ATOX1 monoclonal antibody (M01), clone 2E6. Analysis of ATOX1 expression in human liver.

Immunocytochemistry/Immunofluorescence: ATOX1 Antibody (2E6) [H00000475-M01] - Analysis of monoclonal antibody to ATOX1 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: ATOX1 Antibody (2E6) [H00000475-M01] - ATOX1 monoclonal antibody (M01), clone 2E6. Analysis of ATOX1 expression in COLO 320 HSR.

Western Blot: ATOX1 Antibody (2E6) [H00000475-M01] - ATOX1 monoclonal antibody (M01), clone 2E6 Analysis of ATOX1 expression in Hela S3 NE.

Sandwich ELISA: ATOX1 Antibody (2E6) [H00000475-M01] - Detection limit for recombinant GST tagged ATOX1 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 2E6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATOX1 Antibody (2E6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
• Specificity: ATOX1 - ATX1 antioxidant protein 1 homolog (yeast)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATOX1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID:34944703).Antibody reactivity against tissue lysate, cell lysate and recombinant protein for WB. It has been used for IF and ELISA..

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATOX1 Antibody (2E6) - Azide and BSA Free

• ATX1 (antioxidant protein 1, yeast) homolog 1
• ATX1 antioxidant protein 1 homolog (yeast)
• ATX1
• copper transport protein ATOX1
• HAH1 MGC138453
• hah1
• Metal transport protein ATX1
• MGC138455

Background

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATOX1 Antibody (H00000475-M01)(3)

Publications using H00000475-M01

• Blockhuys S, HildesjO C, Olsson H et al. Evaluation of ATOX1 as a Potential Predictive Biomarker for Tetrathiomolybdate Treatment of Breast Cancer Patients with High Risk of Recurrence Biomedicines 2021-12-12 [PMID: 34944703] (IHC-P, Human)
• Horvath I, Blockhuys S, Sulskis D et al. Interaction between Copper Chaperone Atox1 and Parkinson's Disease Protein alpha-Synuclein Includes Metal-Binding Sites and Occurs in Living Cells ACS Chem Neurosci 2019-10-24 [PMID: 31600047]
• Davies KM, Hare DJ, Cottam V et al. Localization of copper and copper transporters in the human brain. Metallomics. 2013-01-01 [PMID: 23076575] (Human)

Bioinformatics

• Gene Symbol: ATOX1
• Entrez:
  • 475(Human)
• OMIM:
  • 602270(Human)
• Uniprot:
  • NP_004036(Human)