ATOH7 Antibody (1E5) - Azide and BSA Free

Western Blot: ATOH7 Antibody (1E5) [H00220202-M02] - Analysis of ATOH7 expression in transfected 293T cell line by ATOH7 monoclonal antibody (M02), clone 1E5.Lane 1: ATOH7 transfected lysate(16.9 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATOH7 Antibody (1E5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ATOH7 Antibody (1E5) - Azide and BSA Free (H00220202-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ATOH7 (NP_660161, 53 a.a. ~ 99 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA
• Specificity: ATOH7 (1E5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATOH7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATOH7 Antibody (1E5) - Azide and BSA Free

• ATH5
• atonal homolog 7 (Drosophila)
• BHLHA13
• bHLHa13protein atonal homolog 7
• Class A basic helix-loop-helix protein 13
• hATH5
• Helix-loop-helix protein hATH-5
• Math5

Background

ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATOH7
• Entrez:
  • 220202(Human)
• OMIM:
  • 609875(Human)
• Uniprot:
  • NP_660161(Human)