Atlastin-3 Antibody

Images

 
Western Blot: Atlastin-3 Antibody [NBP2-56000] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: Atlastin-3 Antibody [NBP2-56000] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Atlastin-3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RVAAAASRGADDAMESSKPGPVQVVLVQKDQHSFEL
Specificity
Specificity of human Atlastin-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATL3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Mouse 81%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Atlastin-3 Antibody

  • atlastin 3
  • atlastin GTPase 3
  • atlastin-3
  • DKFZP564J0863
  • EC 3.6.5.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56681
Species: Hu, Mu, Rt, Rb, Sh
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NBP1-90234
Species: Hu
Applications: IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-90230
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98394
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
NBP2-56000
Species: Hu
Applications: WB, ICC/IF

Publications for Atlastin-3 Antibody (NBP2-56000) (0)

There are no publications for Atlastin-3 Antibody (NBP2-56000).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Atlastin-3 Antibody (NBP2-56000) (0)

There are no reviews for Atlastin-3 Antibody (NBP2-56000). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Atlastin-3 Antibody (NBP2-56000) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Atlastin-3 Products

Bioinformatics Tool for Atlastin-3 Antibody (NBP2-56000)

Discover related pathways, diseases and genes to Atlastin-3 Antibody (NBP2-56000). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Atlastin-3 Antibody (NBP2-56000)

Discover more about diseases related to Atlastin-3 Antibody (NBP2-56000).
 

Pathways for Atlastin-3 Antibody (NBP2-56000)

View related products by pathway.

PTMs for Atlastin-3 Antibody (NBP2-56000)

Learn more about PTMs related to Atlastin-3 Antibody (NBP2-56000).

Blogs on Atlastin-3

There are no specific blogs for Atlastin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Atlastin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATL3