ATF6 beta Antibody (4D10) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: ATF6 beta Antibody (4D10) [H00001388-M02] - Analysis of monoclonal antibody to ATF6B on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: ATF6 beta Antibody (4D10) [H00001388-M02] - Detection limit for recombinant GST tagged CREBL1 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 4D10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ATF6 beta Antibody (4D10) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CREBL1 (NP_004372.3, 2 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK
• Specificity: CREBL1 - cAMP responsive element binding protein-like 1 (4D10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ATF6B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for ELISA.
• Control:

  HeLa DTT Treated / Untreated Cell Lysate

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ATF6 beta Antibody (4D10) - Azide and BSA Free

• activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta
• ATF6-beta
• cAMP response element-binding protein-related protein
• cAMP responsive element binding protein-like 1
• CREBL1CREB-RP
• Creb-related protein
• Creb-rp
• cyclic AMP-dependent transcription factor ATF-6 beta
• FLJ10066
• G13cAMP-responsive element-binding protein-like 1
• Protein G13

Background

The protein encoded by this gene bears sequence similarity with the Creb/ATF subfamily of the bZip superfamily of transcription factors. It localizes to both the cytoplasm and the nucleus. The gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATF6B
• Entrez:
  • 1388(Human)
• Uniprot:
  • NP_004372(Human)