ATF5 Antibody

Images

 
Western Blot: ATF5 Antibody [NBP1-89435] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ATF5 Antibody [NBP1-89435] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ATF5 Antibody [NBP1-89435] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATF5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ATF5 Protein (NBP1-89435PEP)
Publications
Read Publication using NBP1-89435.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATF5 Antibody

  • activating transcription factor 5FLJ34666
  • ATFXHMFN0395
  • cAMP-dependent transcription factor ATF-5
  • cyclic AMP-dependent transcription factor ATF-5
  • Transcription factor ATFx

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1310
Species: Hu
Applications: WB, IHC, IP
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-85457
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-14847
Species: Hu, Pm
Applications: IHC, IHC-P
557-NT/CF
Species: Rt
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATF5 Antibody (NBP1-89435)(1)

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
All Species

Reviews for ATF5 Antibody (NBP1-89435) (0)

There are no reviews for ATF5 Antibody (NBP1-89435). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATF5 Antibody (NBP1-89435) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATF5 Products

Bioinformatics Tool for ATF5 Antibody (NBP1-89435)

Discover related pathways, diseases and genes to ATF5 Antibody (NBP1-89435). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATF5 Antibody (NBP1-89435)

Discover more about diseases related to ATF5 Antibody (NBP1-89435).
 

Pathways for ATF5 Antibody (NBP1-89435)

View related products by pathway.

PTMs for ATF5 Antibody (NBP1-89435)

Learn more about PTMs related to ATF5 Antibody (NBP1-89435).
 

Research Areas for ATF5 Antibody (NBP1-89435)

Find related products by research area.

Blogs on ATF5

There are no specific blogs for ATF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATF5