| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 576-675 of Human Ataxin 1 Source: Wheat Germ (in vitro) Amino Acid Sequence: KGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSK |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | ATXN1 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Theoretical MW | 36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Publication using H00006310-Q01 | Applications | Species |
|---|---|---|
| Yoon JH, Abdelmohsen K, Kim J et al. Scaffold function of long non-coding RNA HOTAIR in protein ubiquitination. Nat Commun. 2013-12-11 [PMID: 24326307] |
Research Areas for Ataxin 1 Partial Recombinant Protein (H00006310-Q01)Find related products by research area.
|
|
ATXN2 Identified as New Genetic Risk Factor for Lou Gehrig's Disease (ALS) Ataxin antibodies are used in the study of autosomal dominant cerebellar ataxia (ADCA) diseases. These neurodegenerative disorders are highly heterogeneous, characterized by progressive, irreversible, atrophy of the cerebellum and spinal cord.Ataxin... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ATXN1 |