ATAD2 Antibody (CL0182)

Images

 
Western Blot: ATAD2 Antibody (CL0182) [NBP2-14786] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-ATAD2 monoclonal ...read more
Immunohistochemistry-Paraffin: ATAD2 Antibody (CL0182) [NBP2-14786] - Staining of human liver shows no immunoreactivity in hepatocytes (negative control).
Western Blot: ATAD2 Antibody (CL0182) [NBP2-14786] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: ATAD2 Antibody (CL0182) [NBP2-14786] - Staining of human testis shows strong nuclear positivity in seminiferous tubules.
Simple Western: ATAD2 Antibody (CL0182) [NBP2-14786] - Simple Western lane view shows a specific band for ATAD2 in 0.2 mg/ml of U-251MG sp lysate. This experiment was performed under reducing conditions using the ...read more
Simple Western: ATAD2 Antibody (CL0182) [NBP2-14786] - Electropherogram image(s) of corresponding Simple Western lane view. ATAD2 antibody was used at 1:20 dilution on U-251MG sp lysates(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clone
CL0182
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ATAD2 Antibody (CL0182) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ATAD2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reactivity Notes

Expected species cross reactivity based on sequence identity: Mouse( 82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for ATAD2 Antibody (CL0182)

  • AAA nuclear coregulator cancer-associated protein
  • ANCCA
  • ANCCAMGC131938
  • ATAD2
  • ATPase family AAA domain-containing protein 2
  • ATPase family, AAA domain containing 2
  • CT137
  • DKFZp667N1320
  • EC 3.6.1.3
  • MGC142216
  • MGC29843
  • MGC5254
  • PRO2000

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31357
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-13251
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP1-81545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-06930
Species: Hu
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20212
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATAD2 Antibody (NBP2-14786) (0)

There are no publications for ATAD2 Antibody (NBP2-14786).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATAD2 Antibody (NBP2-14786) (0)

There are no reviews for ATAD2 Antibody (NBP2-14786). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATAD2 Antibody (NBP2-14786) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATAD2 Products

Bioinformatics Tool for ATAD2 Antibody (NBP2-14786)

Discover related pathways, diseases and genes to ATAD2 Antibody (NBP2-14786). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATAD2 Antibody (NBP2-14786)

Discover more about diseases related to ATAD2 Antibody (NBP2-14786).
 

Pathways for ATAD2 Antibody (NBP2-14786)

View related products by pathway.

PTMs for ATAD2 Antibody (NBP2-14786)

Learn more about PTMs related to ATAD2 Antibody (NBP2-14786).
 

Research Areas for ATAD2 Antibody (NBP2-14786)

Find related products by research area.

Blogs on ATAD2

There are no specific blogs for ATAD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATAD2 Antibody (CL0182) and receive a gift card or discount.

Bioinformatics

Gene Symbol ATAD2
Entrez