Aspartate beta hydroxylase Antibody

Images

 
Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69230] - This Anti-ASPH antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.
Immunohistochemistry: Aspartate beta hydroxylase Antibody [NBP1-69230] - Human kidney.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Aspartate beta hydroxylase Antibody Summary

Immunogen
Synthetic peptides corresponding to ASPH(aspartate beta-hydroxylase) The peptide sequence was selected from the N terminal of ASPH. Peptide sequence SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASPH
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
Testis Lysate (NB820-60623)
HeLa Lysate (NBL1-26467)
Rectum Lysate (NB820-60609)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Aspartate beta hydroxylase Antibody

  • AAH
  • ASP beta-hydroxylase
  • aspartate beta-hydroxylaseA beta H-J-J
  • aspartyl/asparaginyl-beta-hydroxylase
  • BAH
  • cardiac junctin
  • CASQ2BP1
  • EC 1.14.11.16
  • HAAHaspartyl/asparaginyl beta-hydroxylase
  • humbug
  • JCTN
  • junctate
  • junctin
  • Peptide-aspartate beta-dioxygenase

Background

ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69230
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Aspartate beta hydroxylase Antibody (NBP1-69230) (0)

There are no publications for Aspartate beta hydroxylase Antibody (NBP1-69230).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aspartate beta hydroxylase Antibody (NBP1-69230) (0)

There are no reviews for Aspartate beta hydroxylase Antibody (NBP1-69230). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aspartate beta hydroxylase Antibody (NBP1-69230) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Aspartate beta hydroxylase Products

Bioinformatics Tool for Aspartate beta hydroxylase Antibody (NBP1-69230)

Discover related pathways, diseases and genes to Aspartate beta hydroxylase Antibody (NBP1-69230). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aspartate beta hydroxylase Antibody (NBP1-69230)

Discover more about diseases related to Aspartate beta hydroxylase Antibody (NBP1-69230).
 

Pathways for Aspartate beta hydroxylase Antibody (NBP1-69230)

View related products by pathway.

PTMs for Aspartate beta hydroxylase Antibody (NBP1-69230)

Learn more about PTMs related to Aspartate beta hydroxylase Antibody (NBP1-69230).
 

Research Areas for Aspartate beta hydroxylase Antibody (NBP1-69230)

Find related products by research area.

Blogs on Aspartate beta hydroxylase

There are no specific blogs for Aspartate beta hydroxylase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aspartate beta hydroxylase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASPH
Uniprot