Aspartate beta hydroxylase Antibody - BSA Free

Western Blot: Aspartate beta hydroxylase Antibody [NBP1-69230] - This Anti-ASPH antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 2.5ug/ml.

Immunohistochemistry: Aspartate beta hydroxylase Antibody [NBP1-69230] - Human kidney.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

Aspartate beta hydroxylase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ASPH(aspartate beta-hydroxylase) The peptide sequence was selected from the N terminal of ASPH. Peptide sequence SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASPH
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 25 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control:

  Human Testis Membrane Tissue Lysate (Adult Membrane Normal)
  HeLa Membrane Cell Lysate
  Human Rectum Membrane Tissue Lysate (Adult Membrane Normal)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for Aspartate beta hydroxylase Antibody - BSA Free

• AAH
• ASP beta-hydroxylase
• aspartate beta-hydroxylaseA beta H-J-J
• aspartyl/asparaginyl-beta-hydroxylase
• BAH
• cardiac junctin
• CASQ2BP1
• EC 1.14.11.16
• HAAHaspartyl/asparaginyl beta-hydroxylase
• humbug
• JCTN
• junctate
• junctin
• Peptide-aspartate beta-dioxygenase

Background

ASPH is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.This gene is thought to play an important role in calcium homeostasis. Alternative splicing of this gene results in five transcript variants which vary in protein translation, the coding of catalytic domains, and tissue expression. Variation among these transcripts impacts their functions which involve roles in the calcium storage and release process in the endoplasmic and sarcoplasmic reticulum as well as hydroxylation of aspartic acid and asparagine in epidermal growth factor-like domains of various proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aspartate beta hydroxylase Antibody (NBP1-69230)(1)

Publication using NBP1-69230

• Kanwal, M;Smahelova, J;Ciharova, B;Johari, SD;Nunvar, J;Olsen, M;Smahel, M; Aspartate ?-hydroxylase Regulates Expression of Ly6 Genes Journal of Cancer 2024-01-01 [PMID: 38356711]

Bioinformatics

• Gene Symbol: ASPH
• Uniprot:
  • Q9NRI0(Human)