ASIP Antibody - BSA Free

Western Blot: ASIP Antibody [NBP3-10798] - Western blot analysis of ASIP in Human PANC1 Whole Cell lysates. Antibody dilution at 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ASIP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ASIP Antibody - BSA Free (NBP3-10798) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ASIP (NP_001663.2). Peptide sequence CFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRK
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ASIP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 14 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ASIP Antibody - BSA Free

• agouti (mouse)-signaling protein
• agouti signaling protein
• agouti signaling protein, nonagouti homolog (mouse)
• agouti signaling protein, nonagouti homolog
• Agouti switch protein
• agouti-signaling protein
• AGSW
• AGTI
• AGTIL
• AGTILMGC126092
• ASIP
• ASPAGSW
• MGC126093
• nonagouti homolog
• SHEP9

Background

The agouti signaling protein (ASIP) is an adaptor protein involved in asymmetrical cell division and cell polarization processes. ASIP seems to play a central role in the formation of epithelial tight junctions. ASIP may affect the quality of hair pigmentation, and act as a pharmacological antagonist of alpha-melanocyte-stimulating hormone (2-3). ASIP may also play a role in neuroendocrine aspects of melanocortin action, and have a functional role in regulating lipid metabolism in adipocytes (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ASIP