ASIP Antibody

Images

 
Western Blot: ASIP Antibody [NBP3-10798] - Western blot analysis of ASIP in Human PANC1 Whole Cell lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASIP Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ASIP (NP_001663.2). Peptide sequence CFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRK
Clonality
Polyclonal
Host
Rabbit
Gene
ASIP
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for ASIP Antibody

  • agouti (mouse)-signaling protein
  • agouti signaling protein
  • agouti signaling protein, nonagouti homolog (mouse)
  • agouti signaling protein, nonagouti homolog
  • Agouti switch protein
  • agouti-signaling protein
  • AGSW
  • AGTI
  • AGTIL
  • AGTILMGC126092
  • ASIP
  • ASPAGSW
  • MGC126093
  • nonagouti homolog
  • SHEP9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NLS1040
Species: Hu, Pm
Applications: IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
DAGR00
Species: Hu
Applications: ELISA
NBP1-88370
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-41103
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
D6050
Species: Hu
Applications: ELISA
NBP3-10798
Species: Hu
Applications: WB

Publications for ASIP Antibody (NBP3-10798) (0)

There are no publications for ASIP Antibody (NBP3-10798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASIP Antibody (NBP3-10798) (0)

There are no reviews for ASIP Antibody (NBP3-10798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASIP Antibody (NBP3-10798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASIP Products

Bioinformatics Tool for ASIP Antibody (NBP3-10798)

Discover related pathways, diseases and genes to ASIP Antibody (NBP3-10798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASIP Antibody (NBP3-10798)

Discover more about diseases related to ASIP Antibody (NBP3-10798).
 

Pathways for ASIP Antibody (NBP3-10798)

View related products by pathway.

PTMs for ASIP Antibody (NBP3-10798)

Learn more about PTMs related to ASIP Antibody (NBP3-10798).
 

Research Areas for ASIP Antibody (NBP3-10798)

Find related products by research area.

Blogs on ASIP

There are no specific blogs for ASIP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASIP