ASCL3 Antibody

Images

 
Western Blot: ASCL3 Antibody [NBP3-10429] - Western blot analysis using NBP3-10429 on Mouse Muscle as a positive control. Antibody Titration: 0.2-1 ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASCL3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ASCL3 (NP_064435). Peptide sequence GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPR
Clonality
Polyclonal
Host
Rabbit
Gene
ASCL3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for ASCL3 Antibody

  • achaete-scute complex homolog 3 (Drosophila)
  • ASH-3
  • bHLH transcription factor Sgn-1 (Salivary Glands 1)
  • bHLH transcriptional regulator Sgn-1
  • BHLHA42
  • bHLHa42achaete-scute homolog 3
  • Class A basic helix-loop-helix protein 42
  • hASH3
  • HASH3achaete-scute complex (Drosophila) homolog-like 3
  • Sgn1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-22478
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-40877
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-92741
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NBP2-15253
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-46420
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-89270
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16401
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-57150
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB110-56916
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB120-6125
Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB
NBP1-33105
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
MAB1678
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP3-10429
Species: Mu
Applications: WB

Publications for ASCL3 Antibody (NBP3-10429) (0)

There are no publications for ASCL3 Antibody (NBP3-10429).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASCL3 Antibody (NBP3-10429) (0)

There are no reviews for ASCL3 Antibody (NBP3-10429). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASCL3 Antibody (NBP3-10429) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASCL3 Products

Bioinformatics Tool for ASCL3 Antibody (NBP3-10429)

Discover related pathways, diseases and genes to ASCL3 Antibody (NBP3-10429). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASCL3 Antibody (NBP3-10429)

Discover more about diseases related to ASCL3 Antibody (NBP3-10429).
 

Pathways for ASCL3 Antibody (NBP3-10429)

View related products by pathway.

PTMs for ASCL3 Antibody (NBP3-10429)

Learn more about PTMs related to ASCL3 Antibody (NBP3-10429).

Blogs on ASCL3

There are no specific blogs for ASCL3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASCL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASCL3