ASAH3 Antibody

Images

 
Western Blot: ASAH3 Antibody [NBP1-74125] - Human Fetal Brain Lysate, concentration 1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASAH3 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of ACER1. Immunizing peptide sequence ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACER1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACER1 and was validated on Western blot.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ASAH3 Antibody

  • Acylsphingosine deacylase 3
  • Alkaline CDase 1
  • alkaline ceramidase 1
  • AlkCDase 1
  • ALKCDase1
  • ASAH3
  • EC 3.5.1.23
  • MGC138327
  • MGC138329
  • N-acylsphingosine amidohydrolase (alkaline ceramidase) 3
  • N-acylsphingosine amidohydrolase 3

Background

ACER1 hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid at an optimal pH of 8.0. It has a highly restricted substrate specificity for the natural stereoisomer of ceramide with D-erythro-sphingosine but not D-ribo-phytosphingosine or D-erythro-dihydrosphingosine as a backbone. It may have a role in regulating the levels of bioactive lipids ceramide and sphingosine 1-phosphate, as well as complex sphingolipids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90089
Species: Hu
Applications: IHC, IHC-P
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP2-49326
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32756
Species: Ze
Applications: WB
NBP1-84505
Species: Hu
Applications: IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59941
Species: Hu
Applications: WB, IHC

Publications for ASAH3 Antibody (NBP1-74125) (0)

There are no publications for ASAH3 Antibody (NBP1-74125).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASAH3 Antibody (NBP1-74125) (0)

There are no reviews for ASAH3 Antibody (NBP1-74125). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ASAH3 Antibody (NBP1-74125) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASAH3 Products

ASAH3 NBP1-74125

Bioinformatics Tool for ASAH3 Antibody (NBP1-74125)

Discover related pathways, diseases and genes to ASAH3 Antibody (NBP1-74125). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASAH3 Antibody (NBP1-74125)

Discover more about diseases related to ASAH3 Antibody (NBP1-74125).
 

Pathways for ASAH3 Antibody (NBP1-74125)

View related products by pathway.

PTMs for ASAH3 Antibody (NBP1-74125)

Learn more about PTMs related to ASAH3 Antibody (NBP1-74125).

Blogs on ASAH3

There are no specific blogs for ASAH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASAH3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACER1
Uniprot