PHCA Antibody

Images

 
Immunohistochemistry-Paraffin: PHCA Antibody [NBP2-68894] - Staining of human endometrium shows strong membrane positivity in glandular and endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHCA Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPMFGAVQSVRDGLEKR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACER3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
Recommended conditions for IHC,Retrieval method: HIER pH6
Control Peptide
PHCA Recombinant Protein Antigen (NBP2-68894PEP)

Reactivity Notes

Mouse 82%, Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for PHCA Antibody

  • Alkaline CDase 3
  • alkaline ceramidase 3
  • Alkaline dihydroceramidase SB89
  • Alkaline phytoceramidase
  • aPHC
  • APHCAlkCDase 3
  • EC 3.5.1.-
  • FLJ11238
  • PHCA
  • phytoceramidase, alkaline

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00340485-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-74083
Species: Hu
Applications: WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-05160
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15698
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF6897
Species: Hu, Mu
Applications: IHC, WB
3558-AH
Species: Mu
Applications: EnzAct
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NBP2-68858
Species: Hu
Applications: IHC, IHC-P
NBP2-45519
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89396
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-68894
Species: Hu
Applications: IHC, IHC-P

Publications for PHCA Antibody (NBP2-68894) (0)

There are no publications for PHCA Antibody (NBP2-68894).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHCA Antibody (NBP2-68894) (0)

There are no reviews for PHCA Antibody (NBP2-68894). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PHCA Antibody (NBP2-68894) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHCA Products

Array NBP2-68894

Bioinformatics Tool for PHCA Antibody (NBP2-68894)

Discover related pathways, diseases and genes to PHCA Antibody (NBP2-68894). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHCA Antibody (NBP2-68894)

Discover more about diseases related to PHCA Antibody (NBP2-68894).
 

Pathways for PHCA Antibody (NBP2-68894)

View related products by pathway.

PTMs for PHCA Antibody (NBP2-68894)

Learn more about PTMs related to PHCA Antibody (NBP2-68894).

Blogs on PHCA

There are no specific blogs for PHCA, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHCA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACER3