ART5 Antibody - BSA Free

Western Blot: ART5 Antibody [NBP3-38394] - Western blot analysis of various lysates using ART5 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ART5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ART5 Antibody - BSA Free (NBP3-38394) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-200 of human ART5 (NP_443750.2).
  
  Sequence:
  VPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ART5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 32 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ART5 Antibody - BSA Free

• ADP-ribosyltransferase 5
• EC 2.4.2.31
• ecto-ADP-ribosyltransferase 5
• MGC22848
• Mono(ADP-ribosyl)transferase 5
• NAD(P)(+)--arginine ADP-ribosyltransferase 5

Background

ART5 belongs to the mammalian mono-ADP-ribosyltransferase (ART) family, named for the enzymatic reaction that some of its members - including ART5 - catalyze: the transfer of a single ADP-ribose residue from NAD+ to arginine in the extracellular acceptor protein. Unlike other ARTs, ART5 is thought to be secreted rather than membrane-bound. The effects of the reversible post-translational modification catalyzed by these ectoenzymes are currently under investigation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ART5