ART5 Antibody - BSA Free

Immunohistochemistry: ART5 Antibody [NBP2-48744] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ART5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ART5 Antibody - BSA Free (NBP2-48744) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ART5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ART5 Recombinant Protein Antigen (NBP2-48744PEP)

Reactivity Notes

Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ART5 Antibody - BSA Free

• ADP-ribosyltransferase 5
• EC 2.4.2.31
• ecto-ADP-ribosyltransferase 5
• MGC22848
• Mono(ADP-ribosyl)transferase 5
• NAD(P)(+)--arginine ADP-ribosyltransferase 5

Background

ART5 belongs to the mammalian mono-ADP-ribosyltransferase (ART) family, named for the enzymatic reaction that some of its members - including ART5 - catalyze: the transfer of a single ADP-ribose residue from NAD+ to arginine in the extracellular acceptor protein. Unlike other ARTs, ART5 is thought to be secreted rather than membrane-bound. The effects of the reversible post-translational modification catalyzed by these ectoenzymes are currently under investigation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ART5