Recombinant Human ARPM1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARPM1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 24 - 124 of Human ARPM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ACTRT3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARPM1 Protein

  • actin related protein M1
  • actin-related protein M1
  • MGC15664

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89006
Species: Hu
Applications: WB, IHC, IHC-P
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34951
Species: Hu
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-15274
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
H00084517-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for ARPM1 Partial Recombinant Protein (H00084517-Q01) (0)

There are no publications for ARPM1 Partial Recombinant Protein (H00084517-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARPM1 Partial Recombinant Protein (H00084517-Q01) (0)

There are no reviews for ARPM1 Partial Recombinant Protein (H00084517-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARPM1 Partial Recombinant Protein (H00084517-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARPM1 Products

Bioinformatics Tool for ARPM1 Partial Recombinant Protein (H00084517-Q01)

Discover related pathways, diseases and genes to ARPM1 Partial Recombinant Protein (H00084517-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ARPM1

There are no specific blogs for ARPM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARPM1 Antibody
NBP1-90910

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARPM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTRT3