ACTRT2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIVLSGGTTLFHGLDDRLLKELEQLASKDTPIKITAP |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ACTRT2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ACTRT2 Antibody
Background
ACTRT2, also known as Actin-related protein T2, consists of a short 377 amino acid isoform that is 42 kDa, and is involved in cytoskeletal organization especially pertaining to synthesis during spermatid differentiation in the testis. The protein is currently being studied in its relation to malaria. There are no known interactions with other proteins or pathways at this time.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Publications for ACTRT2 Antibody (NBP1-89006) (0)
There are no publications for ACTRT2 Antibody (NBP1-89006).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ACTRT2 Antibody (NBP1-89006) (0)
There are no reviews for ACTRT2 Antibody (NBP1-89006).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ACTRT2 Antibody (NBP1-89006) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ACTRT2 Products
Bioinformatics Tool for ACTRT2 Antibody (NBP1-89006)
Discover related pathways, diseases and genes to ACTRT2 Antibody (NBP1-89006). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Blogs on ACTRT2