ARNTL2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ARNTL2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ARNTL2.

  Source: E. coli

  Amino Acid Sequence: IVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: ARNTL2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55861.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ARNTL2 Recombinant Protein Antigen

• Aryl hydrocarbon receptor nuclear translocator-like protein 2
• Basic-helix-loop-helix-PAS protein MOP9
• bHLHe6
• BMAL2
• Brain and muscle ARNT-like 2
• Class E basic helix-loop-helix protein 6
• CLIF
• CYCLE-like factor
• Member of PAS protein 9
• MOP9
• PAS domain-containing protein 9
• PASD9
• Transcription Factor BMAL2

Background

ARNTL2, or Aryl hydrocarbon receptor nuclear translocator-like protein 2, contains multiple isoforms that are 71 kDa, 69 kDa, 67 kDa, 66 kDa, 65.5 kDa, 65 kDa, 64 kDa, 61 kDa, and 60 kDa, and is involved in the activation of E-box element transcription. The protein has been linked to a variety of diseases and disorders through current research, including hypoxia, alcoholism, bipolar disorder, neuronitis, lupus erythematosus, schizophrenia, schizoaffective disorder, anemia, mood disorder, and Fanconi's anemia. ARNTL2 is associated with circadian rhythm and the regulation of transcription, and interacts with CLOCK, EPAS1, UBC, SERPINE1, and NPAS2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: ARNTL2