ARNTL2 Antibody

Western Blot: ARNTL2 Antibody [NBP2-32423] - Analysis in human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: ARNTL2 Antibody [NBP2-32423] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ARNTL2 Antibody [NBP2-32423] - Staining of human hippocampus shows strong nuclear membranous positivity in neuronal cells.

Product Discontinued

ARNTL2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARNTL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARNTL2 Antibody

• Aryl hydrocarbon receptor nuclear translocator-like protein 2
• Basic-helix-loop-helix-PAS protein MOP9
• bHLHe6
• BMAL2
• Brain and muscle ARNT-like 2
• Class E basic helix-loop-helix protein 6
• CLIF
• CYCLE-like factor
• Member of PAS protein 9
• MOP9
• PAS domain-containing protein 9
• PASD9
• Transcription Factor BMAL2

Background

ARNTL2, or Aryl hydrocarbon receptor nuclear translocator-like protein 2, contains multiple isoforms that are 71 kDa, 69 kDa, 67 kDa, 66 kDa, 65.5 kDa, 65 kDa, 64 kDa, 61 kDa, and 60 kDa, and is involved in the activation of E-box element transcription. The protein has been linked to a variety of diseases and disorders through current research, including hypoxia, alcoholism, bipolar disorder, neuronitis, lupus erythematosus, schizophrenia, schizoaffective disorder, anemia, mood disorder, and Fanconi's anemia. ARNTL2 is associated with circadian rhythm and the regulation of transcription, and interacts with CLOCK, EPAS1, UBC, SERPINE1, and NPAS2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARNTL2