ARNTL2 Antibody

Images

 
Western Blot: ARNTL2 Antibody [NBP2-32423] - Analysis in human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ARNTL2 Antibody [NBP2-32423] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARNTL2 Antibody [NBP2-32423] - Staining of human hippocampus shows strong nuclear membranous positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARNTL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARNTL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARNTL2 Protein (NBP2-32423PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARNTL2 Antibody

  • Aryl hydrocarbon receptor nuclear translocator-like protein 2
  • Basic-helix-loop-helix-PAS protein MOP9
  • bHLHe6
  • BMAL2
  • Brain and muscle ARNT-like 2
  • Class E basic helix-loop-helix protein 6
  • CLIF
  • CYCLE-like factor
  • Member of PAS protein 9
  • MOP9
  • PAS domain-containing protein 9
  • PASD9
  • Transcription Factor BMAL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2288
Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NB100-126
Species: Hu, Mu
Applications: ChIP, WB
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
NB100-125
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-31363
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-00749
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3764
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-1800
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
NBP1-19613
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-86436
Species: Hu
Applications: IHC, IHC-P
NBP1-83837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, IP, PLA, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
NBP2-32423
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARNTL2 Antibody (NBP2-32423) (0)

There are no publications for ARNTL2 Antibody (NBP2-32423).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARNTL2 Antibody (NBP2-32423) (0)

There are no reviews for ARNTL2 Antibody (NBP2-32423). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARNTL2 Antibody (NBP2-32423) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ARNTL2 Products

Bioinformatics Tool for ARNTL2 Antibody (NBP2-32423)

Discover related pathways, diseases and genes to ARNTL2 Antibody (NBP2-32423). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARNTL2 Antibody (NBP2-32423)

Discover more about diseases related to ARNTL2 Antibody (NBP2-32423).
 

Pathways for ARNTL2 Antibody (NBP2-32423)

View related products by pathway.

Blogs on ARNTL2

There are no specific blogs for ARNTL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARNTL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARNTL2