ARNTL2 Antibody


Western Blot: ARNTL2 Antibody [NBP2-32423] - Analysis in human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ARNTL2 Antibody [NBP2-32423] - Staining of human cell line PC-3 shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARNTL2 Antibody [NBP2-32423] - Staining of human hippocampus shows strong nuclear membranous positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ARNTL2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: RIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKD
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARNTL2 Protein (NBP2-32423PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ARNTL2 Antibody

  • Aryl hydrocarbon receptor nuclear translocator-like protein 2
  • Basic-helix-loop-helix-PAS protein MOP9
  • bHLHe6
  • BMAL2
  • Brain and muscle ARNT-like 2
  • Class E basic helix-loop-helix protein 6
  • CLIF
  • CYCLE-like factor
  • Member of PAS protein 9
  • MOP9
  • PAS domain-containing protein 9
  • PASD9
  • Transcription Factor BMAL2


ARNTL2, or Aryl hydrocarbon receptor nuclear translocator-like protein 2, contains multiple isoforms that are 71 kDa, 69 kDa, 67 kDa, 66 kDa, 65.5 kDa, 65 kDa, 64 kDa, 61 kDa, and 60 kDa, and is involved in the activation of E-box element transcription. The protein has been linked to a variety of diseases and disorders through current research, including hypoxia, alcoholism, bipolar disorder, neuronitis, lupus erythematosus, schizophrenia, schizoaffective disorder, anemia, mood disorder, and Fanconi's anemia. ARNTL2 is associated with circadian rhythm and the regulation of transcription, and interacts with CLOCK, EPAS1, UBC, SERPINE1, and NPAS2.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Hu, Mu
Applications: ChIP, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, CHIP-SEQ, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: CHIP-SEQ, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARNTL2 Antibody (NBP2-32423) (0)

There are no publications for ARNTL2 Antibody (NBP2-32423).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARNTL2 Antibody (NBP2-32423) (0)

There are no reviews for ARNTL2 Antibody (NBP2-32423). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARNTL2 Antibody (NBP2-32423) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ARNTL2 Antibody and receive a gift card or discount.


Gene Symbol ARNTL2