Recombinant Human ARNT2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human ARNT2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-217 of Human ARNT2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGQWSSLYEAV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ARNT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
50.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARNT2 GST (N-Term) Protein

  • ARNT protein 2
  • aryl-hydrocarbon receptor nuclear translocator 2
  • bHLHe1BHLHE1
  • Class E basic helix-loop-helix protein 1
  • KIAA0307aryl hydrocarbon receptor nuclear translocator 2

Background

This gene encodes a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. The encoded protein acts as a partner for several sensor proteins of the bHLH-PAS family, forming heterodimers with the sensor proteins that bind regulatory DNA sequences in genes responsive to developmental and environmental stimuli. Under hypoxic conditions, the encoded protein complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. A highly similar protein in mouse forms functional complexes with both aryl hydrocarbon receptors and Single-minded proteins, suggesting addition roles for the encoded protein in the metabolism of xenobiotic compounds and the regulation of neurogenesis, respectively. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-124
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC,  IHC-P, IP, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-84260
Species: Mu
Applications: IHC,  IHC-P, WB
NBP1-68864
Species: Mu
Applications: PEP-ELISA, WB
NBP2-47252
Species: Mu, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-41281
Species: Hu
Applications: WB
NB100-122
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-21585
Species: Pm, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DBD00
Species: Hu
Applications: ELISA
NBP3-03807
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
MEP00B
Species: Mu
Applications: ELISA
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-47345
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB

Publications for ARNT2 Recombinant Protein (H00009915-P02) (0)

There are no publications for ARNT2 Recombinant Protein (H00009915-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARNT2 Recombinant Protein (H00009915-P02) (0)

There are no reviews for ARNT2 Recombinant Protein (H00009915-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARNT2 Recombinant Protein (H00009915-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARNT2 Products

Research Areas for ARNT2 Recombinant Protein (H00009915-P02)

Find related products by research area.

Blogs on ARNT2.

Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more...
AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARNT2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARNT2