ARMER Antibody - Azide and BSA Free

Western Blot: ARMER Antibody [H00023204-B02P] - Analysis of ARL6IP expression in human liver.

Western Blot: ARMER Antibody [H00023204-B02P] - Analysis of ARL6IP1 expression in transfected 293T cell line by ARL6IP1 polyclonal antibody. Lane 1: ARL6IP transfected lysate(22.33 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ARMER Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ARMER Antibody - Azide and BSA Free (H00023204-B02P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ARL6IP1 (NP_055976.1, 1 a.a. - 203 a.a.) full-length human protein. MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE
• Specificity: ARL6IP1 - ADP-ribosylation factor-like 6 interacting protein 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ARL6IP1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARMER Antibody - Azide and BSA Free

• ADP-ribosylation factor-like 6 interacting protein 1
• ADP-ribosylation factor-like 6 interacting protein
• AIP1
• Aip-1
• apoptotic regulator in the membrane of the endoplasmic reticulum
• ARL-6-interacting protein 1
• ARL6IPaip-1
• ARMER
• KIAA0069ADP-ribosylation factor-like protein 6-interacting protein 1

Background

Apoptosis is important for normal development and tissue homeostasis. It is mediated by various caspases and ultimately results in the activation of endogenous endonucleases that degrade cellular DNA. Although apoptosis induced by endoplasmic reticulum (ER) stress is thought to be mediated by caspase-12, other caspases such as caspase-9 are also thought to be activated following ER stress. Recently, ARMER, a novel integral ER-membrane protein was shown to protect cells from ER stress-induced apoptosis. Analysis of the caspase proteolytic cascade suggests that ARMER acts by inhibiting caspase-9 activity (3), although the mechanism for this remains unkown. It should be noted that ARMER is not related to the inhibitor of apoptosis proteins (IAP) family and does not contain any baculoviral IAP repeat (BIR) domains.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARL6IP1
• Entrez:
  • 23204(Human)
• Uniprot:
  • NP_055976.1(Human)