ARL6 Antibody

Images

 
Western Blot: ARL6 Antibody [NBP1-88689] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ARL6 Antibody [NBP1-88689] - Staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
Immunohistochemistry: ARL6 Antibody [NBP1-88689] - Staining of human kidney shows strong cytoplasmic positivity in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARL6 Protein (NBP1-88689PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARL6 Antibody

  • ADP-ribosylation factor-like 6
  • ADP-ribosylation factor-like protein 6
  • Bardet-Biedl syndrome 3 protein
  • BBS3
  • MGC32934
  • RP55

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP2-34106
Species: Hu
Applications: IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77198
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
BC110-60480
Species: Hu, Mu
Applications: ICC/IF, PEP-ELISA
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-88688
Species: Hu
Applications: IHC, IHC-P
NBP2-46542
Species: Hu
Applications: WB, IHC
NB100-75457
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-55775
Species: Hu
Applications: WB, ICC/IF

Publications for ARL6 Antibody (NBP1-88689) (0)

There are no publications for ARL6 Antibody (NBP1-88689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL6 Antibody (NBP1-88689) (0)

There are no reviews for ARL6 Antibody (NBP1-88689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARL6 Antibody (NBP1-88689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL6 Products

Bioinformatics Tool for ARL6 Antibody (NBP1-88689)

Discover related pathways, diseases and genes to ARL6 Antibody (NBP1-88689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL6 Antibody (NBP1-88689)

Discover more about diseases related to ARL6 Antibody (NBP1-88689).
 

Pathways for ARL6 Antibody (NBP1-88689)

View related products by pathway.

PTMs for ARL6 Antibody (NBP1-88689)

Learn more about PTMs related to ARL6 Antibody (NBP1-88689).
 

Research Areas for ARL6 Antibody (NBP1-88689)

Find related products by research area.

Blogs on ARL6

There are no specific blogs for ARL6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6