ARL1 Antibody

Images

 
Western Blot: ARL1 Antibody [NBP1-98485] - HepG2 Cell Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

ARL1 Antibody Summary

Immunogen
The immunogen for this antibody is ARL1 - C-terminal region. Peptide sequence: SKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDRK
Clonality
Polyclonal
Host
Rabbit
Gene
ARL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARL1 Antibody

  • ADP-ribosylation factor-like 1
  • ADP-ribosylation factor-like protein 1
  • ARFL1

Background

The protein encoded by this gene belongs to the ARL (ADP-ribosylation factor-like) family of proteins, which are structurally related to ADP-ribosylation factors (ARFs). ARFs, described as activators of cholera toxin (CT) ADP-ribosyltransferase activity, regulate intracellular vesicular membrane trafficking, and stimulate a phospholipase D (PLD) isoform. Although, ARL proteins were initially thought not to activate CT or PLD, later work showed that they are weak stimulators of PLD and CT in a phospholipid dependent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38528
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89788
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-93719
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-87255
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91680
Species: Hu
Applications: IHC, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38342
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38831
Species: Hu
Applications: IHC, IHC-P
NBP1-88839
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49630
Species: Hu
Applications: IHC
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-98485
Species: Hu
Applications: WB

Publications for ARL1 Antibody (NBP1-98485) (0)

There are no publications for ARL1 Antibody (NBP1-98485).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL1 Antibody (NBP1-98485) (0)

There are no reviews for ARL1 Antibody (NBP1-98485). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARL1 Antibody (NBP1-98485) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARL1 Antibody Products

Related Products by Gene

Bioinformatics Tool for ARL1 Antibody (NBP1-98485)

Discover related pathways, diseases and genes to ARL1 Antibody (NBP1-98485). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL1 Antibody (NBP1-98485)

Discover more about diseases related to ARL1 Antibody (NBP1-98485).
 

Pathways for ARL1 Antibody (NBP1-98485)

View related products by pathway.

PTMs for ARL1 Antibody (NBP1-98485)

Learn more about PTMs related to ARL1 Antibody (NBP1-98485).
 

Research Areas for ARL1 Antibody (NBP1-98485)

Find related products by research area.

Blogs on ARL1

There are no specific blogs for ARL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol ARL1
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-98485 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought