Recombinant Human ARID5B GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (XP_084482) for Human ARID5B Source: Wheat Germ (in vitro) Amino Acid Sequence: SGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
ARID5B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
| Theoretical MW |
36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human ARID5B GST (N-Term) Protein
Background
ARID5B (AT-rich interactive domain-containing protein 5B) is also known as MRF-2 (modulator recognition factor 2) and is member of the AT-rich interaction domain (ARID) family of proteins. Studies of ARID5B in knockout mice indicate a role in the regulation of adipocyte differentiation and leptin expression.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Publications for ARID5B Recombinant Protein (H00084159-Q01) (0)
There are no publications for ARID5B Recombinant Protein (H00084159-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ARID5B Recombinant Protein (H00084159-Q01) (0)
There are no reviews for ARID5B Recombinant Protein (H00084159-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ARID5B Recombinant Protein (H00084159-Q01) (0)
Additional ARID5B Products
Blogs on ARID5B