Recombinant Human ARID1A GST (N-Term) Protein

SDS-Page: Recombinant Human ARID1A Protein [H00008289-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human ARID1A GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1216-1325 of Human ARID1A
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: ARID1A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 37.84 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARID1A GST (N-Term) Protein

• ARID domain-containing protein 1A
• AT rich interactive domain 1A (SWI- like)
• AT rich interactive domain 1A (SWI-like)
• AT-rich interactive domain-containing protein 1A
• B120SWI-like protein
• BAF250a
• BAF250SWI/SNF complex protein p270
• BM029
• brain protein 120
• BRG1-associated factor 250
• BRG1-associated factor 250a
• C10rf4
• C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1
• chromatin remodeling factor p250
• hELD
• hOSA1
• matrix associated, actin dependent regulator of chromatin
• Osa homolog 1
• OSA1 nuclear protein
• OSA1
• P270
• SMARCF1
• subfamily f, member 1

Background

ARID1A - AT rich interactive domain 1A (SWI- like)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for ARID1A Partial Recombinant Protein (H00008289-Q01)(1)

Publication using H00008289-Q01

• Samikkannu T, Atluri VS, Nair MP. HIV and Cocaine Impact Glial Metabolism: Energy Sensor AMP-activated protein kinase Role in Mitochondrial Biogenesis and Epigenetic Remodeling. Sci Rep. 2016-08-18 [PMID: 27535703] (WB)

Bioinformatics

• Gene Symbol: ARID1A