Recombinant Human ARID1A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ARID1A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1216-1325 of Human ARID1A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARID1A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00008289-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARID1A Protein

  • ARID domain-containing protein 1A
  • AT rich interactive domain 1A (SWI- like)
  • AT rich interactive domain 1A (SWI-like)
  • AT-rich interactive domain-containing protein 1A
  • B120SWI-like protein
  • BAF250a
  • BAF250SWI/SNF complex protein p270
  • BM029
  • brain protein 120
  • BRG1-associated factor 250
  • BRG1-associated factor 250a
  • C10rf4
  • C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1
  • chromatin remodeling factor p250
  • hELD
  • hOSA1
  • matrix associated, actin dependent regulator of chromatin
  • Osa homolog 1
  • OSA1 nuclear protein
  • OSA1
  • P270
  • SMARCF1
  • subfamily f, member 1

Background

ARID1A - AT rich interactive domain 1A (SWI- like)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
H00057492-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-46403
Species: Hu
Applications: IHC
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for ARID1A Partial Recombinant Protein (H00008289-Q01)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for ARID1A Partial Recombinant Protein (H00008289-Q01) (0)

There are no reviews for ARID1A Partial Recombinant Protein (H00008289-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARID1A Partial Recombinant Protein (H00008289-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARID1A Products

Bioinformatics Tool for ARID1A Partial Recombinant Protein (H00008289-Q01)

Discover related pathways, diseases and genes to ARID1A Partial Recombinant Protein (H00008289-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID1A Partial Recombinant Protein (H00008289-Q01)

Discover more about diseases related to ARID1A Partial Recombinant Protein (H00008289-Q01).
 

Pathways for ARID1A Partial Recombinant Protein (H00008289-Q01)

View related products by pathway.

PTMs for ARID1A Partial Recombinant Protein (H00008289-Q01)

Learn more about PTMs related to ARID1A Partial Recombinant Protein (H00008289-Q01).
 

Research Areas for ARID1A Partial Recombinant Protein (H00008289-Q01)

Find related products by research area.

Blogs on ARID1A

There are no specific blogs for ARID1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
ARID1A Antibody
NBP1-88932

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARID1A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID1A