ARHGEF7 Antibody - BSA Free

Western Blot: ARHGEF7 Antibody [NBP2-84456] - Host: Rabbit. Target Name: ARHGEF7. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

ARHGEF7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGEF7 Antibody - BSA Free (NBP2-84456) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF7. Peptide sequence: RYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEI The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGEF7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ARHGEF7 Antibody - BSA Free

• Beta-Pix
• COOL1COOL-1
• DKFZp686C12170
• DKFZp761K1021
• guanine nucleotide exchange factor 7
• KIAA0142KIAA0412
• Nbla10314
• P50
• P50BP
• P85
• P85COOL1
• P85SPRBETA-PIX
• PAK3
• PAK3BP
• PIXBPAK-interacting exchange factor beta
• Rho guanine nucleotide exchange factor (GEF) 7
• rho guanine nucleotide exchange factor 7
• SH3 domain-containing proline-rich protein

Background

ARHGEF7, also known as Rho guanine nucleotide exchange factor 7, contains many isoforms that are 90 kDa, 87 kDa, 84 kDa, 82 kDa, 73 kDa, and 70 kDa, and is involved in apoptosis regulation, cell migration, and cell spreading. Current disease research is being conducted on ARHGEF7 and its relation to Borjeson-Forssmann-Lehmann Syndrome, t-cell leukemia, breast cancer, Wiskott-Aldrich Syndrome, insulin resistance, neuronitis, pancreatitis, leukemia, neuroblastoma, insulin resistance, adenocarcinoma, and lung cancer. This protein is linked to the GPCR pathway and the RhoA pathway, and it interacts with SCRIB, CBL, GIT1, PAK1, and CBLB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGEF7