Recombinant Human ARHGEF4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ARHGEF4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human ARHGEF4

Source: Wheat Germ

Amino Acid Sequence: MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPHRSPVSVDDLWLEKTQRKKLQKQAHVERRLHIGAVHKDGVK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARHGEF4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARHGEF4 Protein

  • APC-stimulated guanine nucleotide exchange factor 1
  • Asef
  • ASEF1
  • ASEFAPC-stimulated guanine nucleotide exchange factor
  • GEF4
  • KIAA1112
  • Rho guanine nucleotide exchange factor (GEF) 4
  • rho guanine nucleotide exchange factor 4
  • STM6

Background

ARHGEF4 - Rho guanine nucleotide exchange factor (GEF) 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF6260
Species: Hu
Applications: WB
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00050649-Q02
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ARHGEF4 Partial Recombinant Protein (H00050649-Q02) (0)

There are no publications for ARHGEF4 Partial Recombinant Protein (H00050649-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF4 Partial Recombinant Protein (H00050649-Q02) (0)

There are no reviews for ARHGEF4 Partial Recombinant Protein (H00050649-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGEF4 Partial Recombinant Protein (H00050649-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ARHGEF4 Partial Recombinant Protein (H00050649-Q02)

Discover related pathways, diseases and genes to ARHGEF4 Partial Recombinant Protein (H00050649-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF4 Partial Recombinant Protein (H00050649-Q02)

Discover more about diseases related to ARHGEF4 Partial Recombinant Protein (H00050649-Q02).

Research Areas for ARHGEF4 Partial Recombinant Protein (H00050649-Q02)

Find related products by research area.

Blogs on ARHGEF4

There are no specific blogs for ARHGEF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ARHGEF4 Antibody
NB100-1316

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARHGEF4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF4