Recombinant Human ARHGEF3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ARHGEF3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 33-142 of Human ARHGEF3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARHGEF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARHGEF3 GST (N-Term) Protein

  • DKFZP434F2429
  • Exchange factor found in platelets and leukemic and neuronal tissues
  • FLJ98126
  • MGC118905
  • Rho guanine nucleotide exchange factor (GEF) 3
  • rho guanine nucleotide exchange factor 3,59.8 kDA protein
  • RhoGEF protein
  • XPLNXPLN

Background

ARHGEF3 - Rho guanine nucleotide exchange factor (GEF) 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83237
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF4737
Species: Hu
Applications: WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB300-164
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
AF3749
Species: Hu
Applications: IHC, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
H00057449-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB7848
Species: Hu
Applications: IHC, WB
NBP1-71927
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00050650-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ARHGEF3 Partial Recombinant Protein (H00050650-Q01) (0)

There are no publications for ARHGEF3 Partial Recombinant Protein (H00050650-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF3 Partial Recombinant Protein (H00050650-Q01) (0)

There are no reviews for ARHGEF3 Partial Recombinant Protein (H00050650-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGEF3 Partial Recombinant Protein (H00050650-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGEF3 Products

Bioinformatics Tool for ARHGEF3 Partial Recombinant Protein (H00050650-Q01)

Discover related pathways, diseases and genes to ARHGEF3 Partial Recombinant Protein (H00050650-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF3 Partial Recombinant Protein (H00050650-Q01)

Discover more about diseases related to ARHGEF3 Partial Recombinant Protein (H00050650-Q01).
 

Pathways for ARHGEF3 Partial Recombinant Protein (H00050650-Q01)

View related products by pathway.

Research Areas for ARHGEF3 Partial Recombinant Protein (H00050650-Q01)

Find related products by research area.

Blogs on ARHGEF3

There are no specific blogs for ARHGEF3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RhoA Antibody
NB100-91273

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARHGEF3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF3