ARHGEF15 Antibody

Immunocytochemistry/Immunofluorescence: ARHGEF15 Antibody [NBP2-56334] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & plasma membrane.

Product Discontinued

ARHGEF15 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PSGSPCTPLLPMAGVLAQNGSASAPGTVRRLAGRFEGGAEGRAQDADAPEPGLQARADVNGEREAPLTGSGSQENGAPDA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGEF15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARHGEF15 Antibody

• ARGEF15Rho GEF 15
• E5
• Ephexin5
• Ephexin-5
• FLJ13791
• KIAA0915Vsm-RhoGEFephexin-5
• MGC44868
• Rho guanine exchange factor (GEF) 15
• Rho guanine nucleotide exchange factor (GEF) 15
• rho guanine nucleotide exchange factor 15

Background

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein-coupled receptors. This gene encodes a protein that functions as a specific guanine nucleotide exchange factor for RhoA. It also interacts with ephrin A4 in vascular smooth muscle cells. [provided by RefSeq].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGEF15