Recombinant Human ARHGEF11 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ARHGEF11 Protein [H00009826-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human ARHGEF11 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 651-750 of Human ARHGEF11

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSTSSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDTLLPHLLEDDLGQLSDLEPE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ARHGEF11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARHGEF11 GST (N-Term) Protein

  • DKFZp667F1223
  • glutamate transporter EAAT4-associated protein 48
  • GTRAP48
  • KIAA0380rho guanine nucleotide exchange factor 11
  • PDZ-RHOGEF
  • Rho guanine exchange factor (GEF) 11
  • Rho guanine nucleotide exchange factor (GEF) 11
  • RhoA-specific guanine nucleotide exchange factor
  • RhoGEF glutamate transport modulator

Background

ARHGEF11 - Rho guanine nucleotide exchange factor (GEF) 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4737
Species: Hu
Applications: WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
AF3749
Species: Hu
Applications: IHC, WB
NBP1-82843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-68888
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-80886
Species: Hu
Applications: Flow, IHC, IHC-P, IP, WB
NBP3-09471
Species: Hu
Applications: WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-17050
Species: Hu
Applications: IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-20136
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, In vivo, ISH, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00009826-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for ARHGEF11 Partial Recombinant Protein (H00009826-Q01) (0)

There are no publications for ARHGEF11 Partial Recombinant Protein (H00009826-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF11 Partial Recombinant Protein (H00009826-Q01) (0)

There are no reviews for ARHGEF11 Partial Recombinant Protein (H00009826-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGEF11 Partial Recombinant Protein (H00009826-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ARHGEF11 Products

Bioinformatics Tool for ARHGEF11 Partial Recombinant Protein (H00009826-Q01)

Discover related pathways, diseases and genes to ARHGEF11 Partial Recombinant Protein (H00009826-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGEF11 Partial Recombinant Protein (H00009826-Q01)

Discover more about diseases related to ARHGEF11 Partial Recombinant Protein (H00009826-Q01).
 

Pathways for ARHGEF11 Partial Recombinant Protein (H00009826-Q01)

View related products by pathway.

PTMs for ARHGEF11 Partial Recombinant Protein (H00009826-Q01)

Learn more about PTMs related to ARHGEF11 Partial Recombinant Protein (H00009826-Q01).

Blogs on ARHGEF11

There are no specific blogs for ARHGEF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ARHGEF11 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF11