ARHGDIG Antibody (1D11)

Images

 
Sandwich ELISA: ARHGDIG Antibody (1D11) [H00000398-M01] - Detection limit for recombinant GST tagged ARHGDIG is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ARHGDIG Antibody (1D11) Summary

Immunogen
ARHGDIG (AAH47699, 1 a.a. - 225 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD
Specificity
ARHGDIG - Rho GDP dissociation inhibitor (GDI) gamma
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ARHGDIG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARHGDIG Antibody (1D11)

  • Rho GDI 3
  • Rho GDP dissociation inhibitor (GDI) gamma
  • rho GDP-dissociation inhibitor 3
  • RhoGDI gamma
  • Rho-GDI gamma
  • RHOGDI-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37472
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NB100-56725
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-IC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP1-79794
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3854
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91687
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85783
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000398-M01
Species: Hu
Applications: WB, ELISA

Publications for ARHGDIG Antibody (H00000398-M01) (0)

There are no publications for ARHGDIG Antibody (H00000398-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGDIG Antibody (H00000398-M01) (0)

There are no reviews for ARHGDIG Antibody (H00000398-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGDIG Antibody (H00000398-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGDIG Products

Bioinformatics Tool for ARHGDIG Antibody (H00000398-M01)

Discover related pathways, diseases and genes to ARHGDIG Antibody (H00000398-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARHGDIG Antibody (H00000398-M01)

Discover more about diseases related to ARHGDIG Antibody (H00000398-M01).
 

Pathways for ARHGDIG Antibody (H00000398-M01)

View related products by pathway.

PTMs for ARHGDIG Antibody (H00000398-M01)

Learn more about PTMs related to ARHGDIG Antibody (H00000398-M01).
 

Research Areas for ARHGDIG Antibody (H00000398-M01)

Find related products by research area.

Blogs on ARHGDIG

There are no specific blogs for ARHGDIG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGDIG Antibody (1D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGDIG
Entrez
OMIM
Uniprot