ARHGAP24 Antibody - Azide and BSA Free

Western Blot: ARHGAP24 Antibody [H00083478-B01P] - Analysis of ARHGAP24 expression in transfected 293T cell line by ARHGAP24 polyclonal antibody. Lane 1: ARHGAP24 transfected lysate(71.83 KDa). Lane 2: Non-transfected lysate.

Western Blot: ARHGAP24 Antibody [H00083478-B01P] - analysis of ARHGAP24 expression in transfected 293T cell line by ARHGAP24 MaxPab polyclonal antibody. Lane 1: ARHGAP24 transfected lysate (71.83 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ARHGAP24 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse ARHGAP24 Antibody - Azide and BSA Free (H00083478-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: ARHGAP24 (NP_001036134.1, 1 a.a. - 653 a.a.) full-length human protein. MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ
• Specificity: ARHGAP24 - Rho GTPase activating protein 24,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ARHGAP24
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARHGAP24 Antibody - Azide and BSA Free

• DKFZP564B1162
• Filamin-A-associated RhoGAP
• FilGAP
• FILGAPRCGAP72
• FLJ33877
• p73
• p73RhoGAP
• RAC1- and CDC42-specific GTPase-activating protein of 72 kDa
• RC-GAP72
• Rho GTPase activating protein 24
• rho GTPase-activating protein 24
• RhoGAP of 73 kDa
• Rho-type GTPase-activating protein 24
• Sarcoma antigen NY-SAR-88

Background

ARHGAPs, such as ARHGAP24, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARHGAP24
• Entrez:
  • 83478(Human)
• Uniprot:
  • NP_001036134.1(Human)