ARFGEF2 Antibody - BSA Free

Western Blot: ARFGEF2 Antibody [NBP2-84447] - Host: Rabbit. Target Name: ARFGEF1. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ARFGEF2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARFGEF2 Antibody - BSA Free (NBP2-84447) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARFGEF2. Peptide sequence: SDVLLDDIFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARFGEF2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ARFGEF2 Antibody - BSA Free

• ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldinA-inhibited)
• ARFGEP2
• BIG2brefeldin A-inhibited guanine nucleotide-exchange protein 2
• Brefeldin A-inhibited GEP 2
• dJ1164I10.1
• FLJ23723
• PVNH2

Background

BIG2 promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6. Promotes the activation of ARF1/ARF5/ARF6 through replacement of GDP with GTP. [from: http://www.genecards.org/cgi-bin/carddisp.pl®gene=ARFGEF2&search=BIG2] ARFGEF2 plays an important role in vesicular and membrane trafficking from the trans-golgi network. It is also involved in the activation of ARFs (1,5, and 6) by accelerating replacement of bound GDP with GTP. It also acts as the activator of ADP-ribosylation factor GTPases that are essential for regulating vesicular traffic among intracellular organelles. [from: http://www.dsi.univ-paris5.fr/genatlas/fiche.php®symbol=ARFGEF2]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARFGEF2