ARFGAP1 Antibody - BSA Free

Western Blot: ARFGAP1 Antibody [NBP3-10640] - Western blot analysis using NBP3-10640 on Transfected 293T as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ARFGAP1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARFGAP1 (NP_060679). Peptide sequence WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARFGAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ARFGAP1 Antibody - BSA Free

• ADP-ribosylation factor 1 GTPase activating protein
• ADP-ribosylation factor 1 GTPase-activating protein
• ADP-ribosylation factor GTPase activating protein 1
• ADP-ribosylation factor GTPase-activating protein 1
• ARF GAP 1
• ARF1 GAP
• ARF1-directed GTPase-activating protein
• ARF1GAP
• ARFGAP1
• bA261N11.3
• FLJ10767
• GAP protein
• HRIHFB2281
• MGC39924

Background

ARFGAP1 is encoded by this gene is a GTPase-activating protein (GAP) which associates with the Golgi apparatus and which interacts with ADP-ribosylation factor 1 (ARF1). The encoded protein promotes hydrolysis of ARF1-bound GTP and is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles. Dissociation of the coat proteins is required for the fusion of these vesicles with target compartments. The activity of this protein is stimulated by phosphoinosides and inhibited by phosphatidylcholine. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ARFGAP1