Recombinant Human ARC/NOL3 Protein

Product Discontinued

Recombinant Human ARC/NOL3 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-208 of Human NOL3 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence:MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

• Preparation Method: in vitro wheat germ expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: NOL3

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Application Notes: Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ARC/NOL3 Protein

• Apoptosis repressor with CARD
• ARC
• ARCFLJ35304
• CARD2
• Muscle-enriched cytoplasmic protein
• MYC
• MYP
• NOL3
• NOP30
• NOPnucleolar protein 3
• nucleolar protein 3 (apoptosis repressor with CARD domain)
• Nucleolar protein of 30 kDa

Background

Nop30 (nucleolar protein of 30 kDa) is predominantly expressed in muscle and is present in the nucleoplasm and concentrated in nucleoli. The predominant nucleolar localization of Nop30 points to a potential role in RNA processing in muscle nucleoli. A CARD domain containing protein, designated ARC for apoptosis repressor with CARD is related to Nop30 with a different carboxyl terminus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: NOL3