Aquaporin-5 Recombinant Protein Antigen

Images

 
There are currently no images for Aquaporin-5 Protein (NBP2-39043PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Aquaporin-5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AQP5.

Source: E. coli

Amino Acid Sequence: SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AQP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39043.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Aquaporin-5 Recombinant Protein Antigen

  • AQP5
  • AQP-5
  • Aquaporin 5
  • aquaporin-5
  • PPKB

Background

Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. At least ten isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP9. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7 and AQP9 are permeable to urea and glycerol. AQP2 is the only water channel that is activated by vasopressin to enhance water reabsorption in the kidney collecting duct. Aquaporins are involved in renal water absorption, generation of pulmonary secretions, lacrimation, and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. In the lung, the 27-kDa AQP5 is responsible for the majority of water transport across the apical membrane of type I alveolar epithelial cells. The gene encoding human AQP5 maps to chromosome 12q13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-749
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87679
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-97927
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87201
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-30862
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC-Fr, WB
NBP1-91676
Species: Hu
Applications: IHC,  IHC-P
NBP1-30865
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-92773
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-38045
Species: Hu
Applications: IHC,  IHC-P
NBP2-49440
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
251-KG
Species: Hu
Applications: BA
NBP2-46175
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-39043PEP
Species: Hu
Applications: AC

Publications for Aquaporin-5 Protein (NBP2-39043PEP) (0)

There are no publications for Aquaporin-5 Protein (NBP2-39043PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aquaporin-5 Protein (NBP2-39043PEP) (0)

There are no reviews for Aquaporin-5 Protein (NBP2-39043PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Aquaporin-5 Protein (NBP2-39043PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Aquaporin-5 Products

Research Areas for Aquaporin-5 Protein (NBP2-39043PEP)

Find related products by research area.

Blogs on Aquaporin-5

There are no specific blogs for Aquaporin-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Aquaporin-5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AQP5