Aquaporin-5 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AQP5. Source: E. coli
Amino Acid Sequence: SLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
AQP5 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-39043. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Aquaporin-5 Recombinant Protein Antigen
Background
Aquaporins (AQPs) are a large family of integral membrane water transport channel proteins that facilitate the transport of water through the cell membrane. This function is conserved in animals, plants and bacteria. At least ten isoforms of aquaporin have been identified in mammals, designated AQP0 through AQP9. Aquaporins are widely distributed and it is not uncommon for more than one type of AQP to be present in the same cell. Although most aquaporins are only permeable to water, AQP3, AQP7 and AQP9 are permeable to urea and glycerol. AQP2 is the only water channel that is activated by vasopressin to enhance water reabsorption in the kidney collecting duct. Aquaporins are involved in renal water absorption, generation of pulmonary secretions, lacrimation, and the secretion and reabsorption of cerebrospinal fluid and aqueous humor. In the lung, the 27-kDa AQP5 is responsible for the majority of water transport across the apical membrane of type I alveolar epithelial cells. The gene encoding human AQP5 maps to chromosome 12q13.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Eq, Hu, Mu, Po
Applications: ICC/IF, IHC-Fr, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu
Applications: AC
Publications for Aquaporin-5 Protein (NBP2-39043PEP) (0)
There are no publications for Aquaporin-5 Protein (NBP2-39043PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Aquaporin-5 Protein (NBP2-39043PEP) (0)
There are no reviews for Aquaporin-5 Protein (NBP2-39043PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Aquaporin-5 Protein (NBP2-39043PEP) (0)
Additional Aquaporin-5 Products
Research Areas for Aquaporin-5 Protein (NBP2-39043PEP)
Find related products by research area.
|
Blogs on Aquaporin-5