Aquaporin 1/AQP1 Antibody


Western Blot: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Analysis in control (vector only transfected HEK293T lysate) and aQP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian more
Immunocytochemistry/ Immunofluorescence: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human cell line U-2 OS shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Aquaporin 1/AQP1 Antibody [NBP1-84488] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells of tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Aquaporin 1/AQP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK
Specificity of human Aquaporin 1/AQP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aquaporin 1/AQP1 Protein (NBP1-84488PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Aquaporin 1/AQP1 Antibody

  • 28-kDa
  • AQP1
  • AQP-1
  • aquaporin 1 (channel-forming integral protein, 28kDa)
  • aquaporin 1 (Colton blood group)
  • Aquaporin 1
  • Aquaporin-CHIP
  • CHIP28
  • CHIP2828kDa, CO blood group)
  • CO
  • MGC26324


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Po, Eq
Applications: WB, ICC/IF, IHC, IHC-Fr
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Aquaporin 1/AQP1 Antibody (NBP1-84488) (0)

There are no publications for Aquaporin 1/AQP1 Antibody (NBP1-84488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aquaporin 1/AQP1 Antibody (NBP1-84488) (0)

There are no reviews for Aquaporin 1/AQP1 Antibody (NBP1-84488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aquaporin 1/AQP1 Antibody (NBP1-84488). (Showing 1 - 1 of 1 FAQ).

  1. Are any of your Aquaporin-1 antibodies suitable for live cell staining? I am looking at doing flow cytometry on live cells and further isolation of the positive cells to purify the population.
    • A list of our Aquaporin-1 antibodies suitable for use in flow cytometry can be found using this link. Of note, NB600-741 is known to bind to an extracellular domain, so should be suitable for your use.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Aquaporin 1/AQP1 Antibody (NBP1-84488)

Discover related pathways, diseases and genes to Aquaporin 1/AQP1 Antibody (NBP1-84488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aquaporin 1/AQP1 Antibody (NBP1-84488)

Discover more about diseases related to Aquaporin 1/AQP1 Antibody (NBP1-84488).

Pathways for Aquaporin 1/AQP1 Antibody (NBP1-84488)

View related products by pathway.

PTMs for Aquaporin 1/AQP1 Antibody (NBP1-84488)

Learn more about PTMs related to Aquaporin 1/AQP1 Antibody (NBP1-84488).

Blogs on Aquaporin 1/AQP1

There are no specific blogs for Aquaporin 1/AQP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aquaporin 1/AQP1 Antibody and receive a gift card or discount.


Gene Symbol AQP1