Apolipoprotein L1 Recombinant Protein Antigen

Images

 
There are currently no images for Apolipoprotein L1 Protein (NBP1-89033PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Apolipoprotein L1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human APOL1.

Source: E. coli

Amino Acid Sequence: SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
APOL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89033.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Apolipoprotein L1 Recombinant Protein Antigen

  • APOL
  • APO-L
  • APOL1
  • APO-L1
  • APO-LI
  • APOL-I
  • Apolipoprotein L
  • apolipoprotein L, 1
  • Apolipoprotein L1
  • Apolipoprotein L-I
  • FSGS4

Background

Apolipoproteins are protein components of plasma lipoproteins. The apolipoprotein L gene family encodes six highly homologous proteins designated apoL-I to -VI, which are associated with large high density type lipoproteins (HDL). The human apoL family maps to chromosome 22q12.1- 13.1 within a 127,000-bp region . apoL has been characterized as a pancreas specific, 383-amino acid, 42 kDa protein that contains a 12-amino acid secretory signal peptide. The apoL genes have TATA-less promoters and contain putative sterol regulatory elements, suggesting that transcription of these genes may be coordinated with that of the low density lipoprotein receptor and genes in pathways involving the synthesis of triglycerides and cholesterol. apoL homologs can undergo 10 fold changes in expression during atherosclerotic changes in vascular endothelial cells, which includes the inflammatory reaction of atherosclerotic lesions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31733
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
H00003250-B01P-50ug
Species: Hu
Applications: WB
AF3664
Species: Hu
Applications: Simple Western, WB
NBP2-01367
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF1797
Species: Mu
Applications: Block, WB
NBP1-51531
Species: Hu
Applications: ELISA, IHC,  IHC-P, WB
DHAPG0
Species: Hu
Applications: ELISA
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
NBP1-90127
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB300-917
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB110-53818
Species: Al, Bv, Dr, Fi, Gp, Hu, Mu, Po, Pm, Rt, Xp, Ze
Applications: EM, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, KD, KO, PLA, RIA, Simple Western, WB

Publications for Apolipoprotein L1 Protein (NBP1-89033PEP) (0)

There are no publications for Apolipoprotein L1 Protein (NBP1-89033PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein L1 Protein (NBP1-89033PEP) (0)

There are no reviews for Apolipoprotein L1 Protein (NBP1-89033PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Apolipoprotein L1 Protein (NBP1-89033PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Apolipoprotein L1 Products

Research Areas for Apolipoprotein L1 Protein (NBP1-89033PEP)

Find related products by research area.

Blogs on Apolipoprotein L1

There are no specific blogs for Apolipoprotein L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Apolipoprotein L1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol APOL1