Apolipoprotein L1 Antibody

Images

 
Western Blot: Apolipoprotein L1 Antibody [H00008542-B01P] - Analysis of APOL1 expression in human pancreas.
Western Blot: Apolipoprotein L1 Antibody [H00008542-B01P] - Analysis of APOL1 expression in transfected 293T cell line by APOL1 polyclonal antibody. Lane 1: APOL1 transfected lysate(26.18 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein L1 Antibody Summary

Immunogen
APOL1 (AAH17331.1, 1 a.a. - 238 a.a.) full-length human protein. MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQA
Specificity
APOL1 - apolipoprotein L, 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
APOL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and tissue lysate for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein L1 Antibody

  • APOL
  • APO-L
  • APOL-I
  • Apolipoprotein L
  • apolipoprotein L, 1
  • apolipoprotein L1
  • Apolipoprotein L-I
  • FSGS4

Background

Apolipoprotein A-I is a relatively abundant plasma protein and is the major apoprotein of HDL. It is involved in the formation of most cholesteryl esters in plasma and also promotes efflux of cholesterol from cells. The protein encoded by this gene is a secreted high density lipoprotein which binds to apolipoprotein A-I. This apolipoprotein L family member may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31733
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-51595
Species: Hu
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01367
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-00092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-Fr, PLA
NB100-2270
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF4409
Species: Mu
Applications: WB
NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90127
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA

Publications for Apolipoprotein L1 Antibody (H00008542-B01P) (0)

There are no publications for Apolipoprotein L1 Antibody (H00008542-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein L1 Antibody (H00008542-B01P) (0)

There are no reviews for Apolipoprotein L1 Antibody (H00008542-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein L1 Antibody (H00008542-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein L1 Products

Bioinformatics Tool for Apolipoprotein L1 Antibody (H00008542-B01P)

Discover related pathways, diseases and genes to Apolipoprotein L1 Antibody (H00008542-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein L1 Antibody (H00008542-B01P)

Discover more about diseases related to Apolipoprotein L1 Antibody (H00008542-B01P).
 

Pathways for Apolipoprotein L1 Antibody (H00008542-B01P)

View related products by pathway.

PTMs for Apolipoprotein L1 Antibody (H00008542-B01P)

Learn more about PTMs related to Apolipoprotein L1 Antibody (H00008542-B01P).

Blogs on Apolipoprotein L1

There are no specific blogs for Apolipoprotein L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOL1
Entrez
Uniprot