Apolipoprotein CIII Antibody (8H7)

Images

 
Immunocytochemistry/ Immunofluorescence: Apolipoprotein CIII Antibody (8H7) [H00000345-M06] - Analysis of monoclonal antibody to APOC3 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: Apolipoprotein CIII Antibody (8H7) [H00000345-M06] - Detection limit for recombinant GST tagged APOC3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
8H7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein CIII Antibody (8H7) Summary

Immunogen
APOC3 (NP_000031.1, 21 a.a. - 99 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
APOC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein CIII Antibody (8H7)

  • APOC3
  • APOCIII
  • apo-CIII
  • apoC-III
  • Apolipoprotein C3
  • apolipoprotein C-III
  • MGC150353

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF4497
Species: Hu
Applications: WB, Simple Western
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-57716
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB400-139
Species: Hu, Ha
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-527
Species: Hu, Mu
Applications: WB
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
H00000341-M01
Species: Hu
Applications: WB, ELISA
NBL1-12547
Species: Hu
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
AF7895
Species: Hu
Applications: WB, IHC
AF2009
Species: Hu
Applications: WB, IHC

Publications for Apolipoprotein CIII Antibody (H00000345-M06) (0)

There are no publications for Apolipoprotein CIII Antibody (H00000345-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apolipoprotein CIII Antibody (H00000345-M06) (0)

There are no reviews for Apolipoprotein CIII Antibody (H00000345-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Apolipoprotein CIII Antibody (H00000345-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein CIII Products

Bioinformatics Tool for Apolipoprotein CIII Antibody (H00000345-M06)

Discover related pathways, diseases and genes to Apolipoprotein CIII Antibody (H00000345-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein CIII Antibody (H00000345-M06)

Discover more about diseases related to Apolipoprotein CIII Antibody (H00000345-M06).
 

Pathways for Apolipoprotein CIII Antibody (H00000345-M06)

View related products by pathway.

PTMs for Apolipoprotein CIII Antibody (H00000345-M06)

Learn more about PTMs related to Apolipoprotein CIII Antibody (H00000345-M06).
 

Research Areas for Apolipoprotein CIII Antibody (H00000345-M06)

Find related products by research area.

Blogs on Apolipoprotein CIII

There are no specific blogs for Apolipoprotein CIII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein CIII Antibody (8H7) and receive a gift card or discount.

Bioinformatics

Gene Symbol APOC3
Uniprot