Apolipoprotein C4 Antibody (3D10)

Images

 
Western Blot: Apolipoprotein C4 Antibody (3D10) [H00000346-M01] - Analysis of APOC4 expression in transfected 293T cell line by APOC4 monoclonal antibody (M01), clone 3D10.Lane 1: APOC4 transfected lysate(14.6 KDa).Lane ...read more
Immunoprecipitation: Apolipoprotein C4 Antibody (3D10) [H00000346-M01] - Analysis of APOC4 transfected lysate using anti-APOC4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with APOC4 MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein C4 Antibody (3D10) Summary

Immunogen
APOC4 (AAH20723.1, 27 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Specificity
APOC4 - apolipoprotein C-IV
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
APOC4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000346-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein C4 Antibody (3D10)

  • APOC4
  • apo-CIV
  • apoC-IV
  • Apolipoprotein C4
  • apolipoprotein C-IV

Background

Apolipoprotein (apo)C4 gene is a member of the apolipoprotein gene family. It is expressed in the liver and has a predicted protein structure characteristic of the other genes in this family. Apo C4 is a 3.3-kb gene consisting of 3 exons and 2 introns; it is located 0.5 kb 5' to the APOC2 gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4497
Species: Hu
Applications: Simple Western, WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
H00000341-M01
Species: Hu
Applications: ELISA, Flow, Func, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-508
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1936
Species: Hu
Applications: IP, WB
AF4647
Species: Hu
Applications: IHC, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-90274
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-34247
Species: Ch(-), Hu, Mu(-), Pm, Rt(-)
Applications: Flow-IC, Flow, ICC/IF
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
H00000346-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for Apolipoprotein C4 Antibody (H00000346-M01)(1)

Reviews for Apolipoprotein C4 Antibody (H00000346-M01) (0)

There are no reviews for Apolipoprotein C4 Antibody (H00000346-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apolipoprotein C4 Antibody (H00000346-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein C4 Products

Bioinformatics Tool for Apolipoprotein C4 Antibody (H00000346-M01)

Discover related pathways, diseases and genes to Apolipoprotein C4 Antibody (H00000346-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein C4 Antibody (H00000346-M01)

Discover more about diseases related to Apolipoprotein C4 Antibody (H00000346-M01).
 

Pathways for Apolipoprotein C4 Antibody (H00000346-M01)

View related products by pathway.

PTMs for Apolipoprotein C4 Antibody (H00000346-M01)

Learn more about PTMs related to Apolipoprotein C4 Antibody (H00000346-M01).

Blogs on Apolipoprotein C4

There are no specific blogs for Apolipoprotein C4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein C4 Antibody (3D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol APOC4
Entrez
OMIM
Uniprot