Apolipoprotein A-II/ApoA2 Antibody (1H6)

Images

 
Immunocytochemistry/ Immunofluorescence: Apolipoprotein A-II/ApoA2 Antibody (1H6) [H00000336-M03] - Analysis of monoclonal antibody to APOA2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: Apolipoprotein A-II/ApoA2 Antibody (1H6) [H00000336-M03] - Analysis of monoclonal antibody to APOA2 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 3 ug/ml
ELISA: Apolipoprotein A-II/ApoA2 Antibody (1H6) [H00000336-M03] - Detection limit for recombinant GST tagged APOA2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Apolipoprotein A-II/ApoA2 Antibody (1H6) Summary

Immunogen
APOA2 (AAH05282, 1 a.a. - 100 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Specificity
APOA2 - apolipoprotein A-II (1H6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
APOA2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.
Publications
Read Publication using
H00000336-M03 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apolipoprotein A-II/ApoA2 Antibody (1H6)

  • Alp-2
  • APOA2
  • apoAII
  • Apo-AII
  • ApoA-II
  • Apolipoprotein A2
  • Apolipoprotein AII
  • Apolipoprotein A-II
  • Hdl-1

Background

This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF4497
Species: Hu
Applications: WB, Simple Western
NBL1-12547
Species: Hu
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-05950
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-527
Species: Hu, Mu
Applications: WB
NB400-104
Species: Hu, Mu, Rt, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03) (0)

There are no reviews for Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Apolipoprotein A-II/ApoA2 Products

Bioinformatics Tool for Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03)

Discover related pathways, diseases and genes to Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03)

Discover more about diseases related to Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03).
 

Pathways for Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03)

View related products by pathway.

Research Areas for Apolipoprotein A-II/ApoA2 Antibody (H00000336-M03)

Find related products by research area.

Blogs on Apolipoprotein A-II/ApoA2

There are no specific blogs for Apolipoprotein A-II/ApoA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apolipoprotein A-II/ApoA2 Antibody (1H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol APOA2
Entrez
Uniprot