Recombinant Human APOBEC2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human APOBEC2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-224 of Human APOBEC2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
APOBEC2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human APOBEC2 Protein

  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2
  • ARCD1
  • ARP1
  • EC 3.5.4
  • EC 3.5.4.-
  • probable C->U-editing enzyme APOBEC-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
NBP1-57516
Species: Hu
Applications: WB
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-39019
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06977
Species: Mu
Applications: WB, PEP-ELISA
AF5414
Species: Hu
Applications: WB, Simple Western
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-68205
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-30463
Species: Hu, Mu, Ze
Applications: WB, ICC/IF, IP
H00057180-B01P
Species: Hu
Applications: WB, ELISA
NBP2-53089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
MAB4675
Species: Mu
Applications: WB, IHC, Neut
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP

Publications for APOBEC2 Recombinant Protein (H00010930-P01) (0)

There are no publications for APOBEC2 Recombinant Protein (H00010930-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOBEC2 Recombinant Protein (H00010930-P01) (0)

There are no reviews for APOBEC2 Recombinant Protein (H00010930-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for APOBEC2 Recombinant Protein (H00010930-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional APOBEC2 Products

Bioinformatics Tool for APOBEC2 Recombinant Protein (H00010930-P01)

Discover related pathways, diseases and genes to APOBEC2 Recombinant Protein (H00010930-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for APOBEC2 Recombinant Protein (H00010930-P01)

Discover more about diseases related to APOBEC2 Recombinant Protein (H00010930-P01).
 

Pathways for APOBEC2 Recombinant Protein (H00010930-P01)

View related products by pathway.

PTMs for APOBEC2 Recombinant Protein (H00010930-P01)

Learn more about PTMs related to APOBEC2 Recombinant Protein (H00010930-P01).

Blogs on APOBEC2

There are no specific blogs for APOBEC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

APOBEC2 Antibody
NBP1-57469

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human APOBEC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBEC2